Post Categories Uncategorized Post dateMarch 22, 2025Post last updated dateUpdated March 22, 2025 Piracetam Post author Adenosylmethionine- apoptosisinducerPost read time1 min read Product Name : PiracetamDescription:Piracetam is a compound suggested to be both a nootropic and...
Post Categories Uncategorized Post dateMarch 21, 2025Post last updated dateUpdated March 21, 2025 FGF-10 Protein Post author Adenosylmethionine- apoptosisinducerPost read time7 sec read Name: FGF-10 ProteinSynonyms: Species Name: HumanLabel Name: No TagMarker Name: UnconjugatedAccession: O15520Gene Id: Leu40-Ser208LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHSMolecular...
Post Categories Uncategorized Post dateMarch 21, 2025Post last updated dateUpdated March 21, 2025 TGF-α Protein Post author Adenosylmethionine- apoptosisinducerPost read time7 sec read Name: TGF-α ProteinSynonyms: Species Name: HumanLabel Name: No TagMarker Name: UnconjugatedAccession: P01135Gene Id: Val40-Ala89VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAMolecular...
Post Categories Uncategorized Post dateMarch 21, 2025Post last updated dateUpdated March 21, 2025 MSLN/Mesothelin Protein Post author Adenosylmethionine- apoptosisinducerPost read time9 sec read Name: MSLN/Mesothelin ProteinSynonyms: Species Name: HumanLabel Name: His TagMarker Name: UnconjugatedAccession: Q13421-1Gene Id: Leu37-Arg286,...
Post Categories Uncategorized Post dateMarch 21, 2025Post last updated dateUpdated March 21, 2025 UNC10217938A Post author Adenosylmethionine- apoptosisinducerPost read time45 sec read Product Name : UNC10217938ATag: CAS : 1347749-97-6Chemical Formula:C₂₆H₂₈N₆O₂Molecular Weight : 456.54Physical Form: solidSolubility :...
Post Categories Uncategorized Post dateMarch 21, 2025Post last updated dateUpdated March 21, 2025 Bedaquiline fumarate Post author Adenosylmethionine- apoptosisinducerPost read time2 min read Product Name : Bedaquiline fumarateDescription:Bedaquiline, also known as TMC207 and R207910, is a diarylquinoline...
Post Categories Uncategorized Post dateMarch 20, 2025Post last updated dateUpdated March 20, 2025 Ephrin-A4 Protein Post author Adenosylmethionine- apoptosisinducerPost read time8 sec read Name: Ephrin-A4 ProteinSynonyms: Species Name: HumanLabel Name: His TagMarker Name: UnconjugatedAccession: P52798Gene Id: Leu26-Gly171,...
Post Categories Uncategorized Post dateMarch 20, 2025Post last updated dateUpdated March 20, 2025 OX40/TNFRSF4 Protein Post author Adenosylmethionine- apoptosisinducerPost read time8 sec read Name: OX40/TNFRSF4 ProteinSynonyms: Species Name: HumanLabel Name: His TagMarker Name: UnconjugatedAccession: P43489Gene Id: Leu29-Ala216,...
Post Categories Uncategorized Post dateMarch 20, 2025Post last updated dateUpdated March 20, 2025 NRP1/CD304 Protein Post author Adenosylmethionine- apoptosisinducerPost read time9 sec read Name: NRP1/CD304 ProteinSynonyms: Species Name: HumanLabel Name: Human Fc TagMarker Name: UnconjugatedAccession: AAH07533Gene Id:...
Post Categories Uncategorized Post dateMarch 20, 2025Post last updated dateUpdated March 20, 2025 Z-VEID-FMK (Ready-to-Use) Post author Adenosylmethionine- apoptosisinducerPost read time41 sec read Product Name : Z-VEID-FMK (Ready-to-Use)Sequence: Z-Val-Glu-Ile-Asp-fluoromethylketonePurity: ≥98% (HPLC)Molecular Weight:652.0Solubility : Appearance: Use/Stability : As...