FGF-1/FGF-Acidic Protein | Adenosylmethionine

Name:
FGF-1/FGF-Acidic Protein

Synonyms:

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P05230-1

Gene Id:
Phe16-Asp155MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Molecular Weight:
17kDa (Reducing)

Purity:
＞95% by SDS-PAGE & HPLC

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
null

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM PB, 150mM NaCl, 1mM DTT, pH7.4

Quality Statement:
Human fibroblast growth factor 1 (FGF-1), also known as acidic fibroblast growth factor (FGF-Acidic), is one of the best characterized members of the FGF superfamily. FGF-1 is a powerful mitogen that exhibit potent effects on numerous different types of cells. It plays a number of roles in several important physiological and pathological processes, such as embryonic development, morphogenesis, angiogenesis, wound healing and atheromatosis, carcinogenesis, development, and invasion of cancer. FGF-1 is released extracellularly as a disulfide-linked homodimer and is stored in complex with extracellular heparan sulfate. The association of FGF-1 with heparan sulfate is a prerequisite for its subsequent interaction with FGF receptors. Ligation triggers receptor dimerization, transphosphorylation, and internalization of receptor/FGF complexes.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Complement C3/C3 Proteinweb
FABP1/L-FABP Proteinsupplier
Popular categories:
FGFR-4/CD334
Neural Cell Adhesion Molecule L1

Author: Adenosylmethionine- apoptosisinducer

Related Posts