Name:
IL-10 Protein
Synonyms:
Interleukin-10, Cytokine synthesis inhibitory factor(CSIF)
Species Name:
Porcine
Label Name:
null
Marker Name:
Unconjugated
Accession:
Q29055
Gene Id:
Ser19-Asn175MSIKSENSCIHFPTSLPHMLRELRAAFGPVKSFFQTKDQMGDLLLTGSLLEDFKGYLGCQALSEMIQFYLEDVMPKAESDGEDIKEHVNSLGEKLKTLRLRLRRCHQFLPCENKSKAVEEVKSAFSKLQERGVYKAMGEFDIFINYIEAYMTMKMRKN
Molecular Weight:
18 kDa (Reducing)
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, PH7.4
Quality Statement:
Interleukin 10(IL10), also known as cytokine synthesis inhibitory factor (CSIF), is a secreted protein and belongs to the IL-10 family. IL-10 is secreted by many activated hematopoietic cell types as well as hepatic stellate cells, keratinocytes, and placental cytotrophoblasts. IL-10 is an anti-inflammatory TH2 cytokine that has a critical role in limiting the immune response to pathogens to prevent host damage. As IL-10 in produced in several T helper populations, it is proposed that it provides a feedback loop to limit the effector functions of macrophages and DCs on T cells. Once expressed, IL-10 signals through the IL-10 receptor (IL-10R) to activate STAT3. As IL-10 is a strong inhibitor of inflammation, it has become a viable biomarker for various diseases and conditions as well as a therapeutic molecule for certain conditions. In addition to elevated levels in parasitic infection, high expression levels of IL-10 are also found in retroviral infections inducing immunodeficiency. The immunosuppressive properties of IL-10 suggest a possible clinical use of IL-10 in suppressing rejections of grafts after organ transplantations.
Reference:
1. Kim JM, Brannan CI, Copeland NG, et al. 1992. J Immunol. 148:3618-23.2. Tan JC, Braun S, Rong H, et al. 1995. J Biol Chem. 270:12906-11.3. Pestka S, Krause CD, Sarkar D, et al. 2004. Annu Rev Immunol. 22:929-79.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CARHSP1 ProteinStorage & Stability
IGF-I/IGF-1 ProteinSynonyms
Popular categories:
ADAM23
ALK-2/ACVR1