GSPT1/ERF3A GST&His Protein | Adenosylmethionine

Name:
GSPT1/ERF3A GST&His Protein

Synonyms:
ERF3A;eRF3aFLJ38048;ETF3A;eukaryotic peptide chain release factor GTP-binding subunit ERF3A;Eukaryotic peptide chain release factor subunit 3a;FLJ39067;G1 to S phase transition 1,551G9.2;G1 to S phase transition protein 1 homolog;GST1\n

Species Name:
Human

Label Name:
null

Marker Name:
Unconjugated

Accession:
P15170-1

Gene Id:
Phe294-Asp499MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGGGSGGGSFNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKDGGGSGGGSHHHHHHHH

Molecular Weight:
51kDa (Reducing)

Purity:
＞85% by SDS-PAGE

Physical Appearance Name:
Liquid

Endotoxin Name:
<0.1EU/μg

Reconstitution:

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
50mM Tris, 20mM GSH, 5%Glycerol, pH8.0

Quality Statement:
GSPT1/ERF3A mediates ETF1/ERF1 delivery to stop codons: The eRF1-eRF3-GTP complex binds to a stop codon in the ribosomal A-site.GTP hydrolysis by GSPT1/ERF3A induces a conformational change that leads to its dissociation, permitting ETF1/ERF1 to accommodate fully in the A-site. Binding of eRF1, eRF3, and GTP to pretermination complexes first induces a structural rearrangement that is manifested as a 2 nucleotide forward shift of the toeprint attributed to pretermination complexes that leads to GTP hydrolysis followed by rapid hydrolysis of peptidyl tRNA.

Reference:
Cell. 2016 Nov 17;167(5):1229-1240.e15. doi: 10.1016/j.cell.2016.10.046.Cell. 2006 Jun 16;125(6):1125-36. doi: 10.1016/j.cell.2006.04.035.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IGFBP2 Proteinmedchemexpress
TRXR1/TXNRD1 proteinFormulation
Popular categories:
Rhodopsin-like receptors
Trk Receptors

Author: Adenosylmethionine- apoptosisinducer

Related Posts