Name:
MARCO Protein
Synonyms:
MARCO, SCARA2, Macrophage receptor with collagenous structure, Scavenger receptor class A member 2
Species Name:
Human
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
Q9UEW3
Gene Id:
Met79-Val520 HHHHHHHHHHGGGSGGGSMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRVSHEHLLQRVDNFTQNPGMFRIKGEQGAPGLQGHKGAMGMPGAPGPPGPPAEKGAKGAMGRDGATGPSGPQGPPGVKGEAGLQGPQGAPGKQGATGTPGPQGEKGSKGDGGLIGPKGETGTKGEKGDLGLPGSKGDRGMKGDAGVMGPPGAQGSKGDFGRPGPPGLAGFPGAKGDQGQPGLQGVPGPPGAVGHPGAKGEPGSAGSPGRAGLPGSPGSPGATGLKGSKGDTGLQGQQGRKGESGVPGPAGVKGEQGSPGLAGPKGAPGQAGQKGDQGVKGSSGEQGVKGEKGERGENSVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV
Molecular Weight:
60-75kDa (Reducing)
Purity:
＞95% by SDS-PAGE, >95% by RP-HPLC & >90% by SEC-HPLC
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4.
Quality Statement:
MARCO (macrophage receptor with collagenous structure), also known as SCARA2, is an 80 kDa type II transmembrane glycoprotein that belongs to the class A scavenger receptor family. MARCO is constitutively expressed on the surface of splenic and lymph node macrophages. Its expression is induced on Kupffer cells and alveolar macrophages by microbial infection, chemical irritants, and Th1 polarizing factors. MARCO binds LPS, lipoteichoic acid, and other determinants on Gram positive and negative bacteria. It also binds modified LDL, CpG oligonucleotides, UGRP1, silica, and TiO2. MARCO is required for the organization of the splenic marginal zone and the interaction of local macrophages and B cells.
Reference:
1. Kriemler L, Rudin S, Gawinecka J, Gross F, Arnold M, Schweizer J, Westphal L, Inauen C, Pokorny T, Dittrich T, Toebak A, Arnold M, Christ-Crain M, von Eckardstein A, Rentsch K, Katan M, De Marchis GM. Discordance between LDL-C and apolipoprotein B is associated with large-artery-atherosclerosis ischemic stroke in patients ⩽70 years of age. Eur Stroke J. 2024 Jan 26:23969873231221619. 2. Furlani F, Pota G, Rossi A, Luciani G, Campodoni E, Mocerino F, D’Errico G, Pezzella A, Panseri S, Vitiello G, Sandri M. Designing bioinspired multifunctional nanoplatforms to support wound healing and skin regeneration: Mg-hydroxyapatite meets melanins. Colloids Surf B Biointerfaces. 2024 Jan 15;235:113756.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Galectin-3/LGALS3 ProteinGene ID
VEGF-D ProteinBiological Activity
Popular categories:
B7-1/CD80
Peroxisome Proliferator-activated Receptor
