Name:
FLT-3L Protein
Synonyms:
FL; FLG3L; Flt3 ligand; Flt-3 Ligand; Flt3L; FLT3LG; fms-related tyrosine kinase 3 ligand; SL cytokine
Species Name:
Mouse
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P49772
Gene Id:
Gly27-Arg188MGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR
Molecular Weight:
19kDa (Reducing)
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4
Quality Statement:
FLT-3 ligand promotes long- term expansion and differentiation of human pro-B-cells in the presence of IL-7 or in combination of IL-7 and IL-3.The human FLT-3 ligand also stimulates the proliferation of cells expressing murine FLT-3 receptors. In combination with SCF and IL-3, FLT-3 ligand can cause expansion of cells with the marker spectrum CD34(+) CD38(-). Alone, FLT-3 ligand supports the survival of precursors in the lineage of blood-forming cells such as CFU-GM, CFU- GEMM, and the very primitive high proliferative potential colony-forming cells, HPP- CFC. flt-3 ligand only has marginal effects on progenitors for erythroid cells and megakaryocytes.
Reference:
1.Cancer Res. 2009 Oct 1,69(19):7747-55. 2.Blood, Jul 2009, 114: 835 – 843. 3.J. Immunol., Jun 2009, 182: 7408 – 7414.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Muellerian-inhibiting factor/AMH ProteinMolecular Weight
EIF5A Proteinweb
Popular categories:
Leukocyte Immunoglobulin Like Receptor B5/LIR-8
Insulin-like Growth Factor 2 R
