Name:
IL-18 Protein
Synonyms:
IGIF, IL-18, IL1F4
Species Name:
Rat
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P97636-1
Gene Id:
His37-Ser194HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS
Molecular Weight:
18kDa (Reducing)
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
20mM Tris, 200mM NaCl, pH8.0
Quality Statement:
Interleukin 18 (IL-18) is a pleiotropic cytokine involved in the regulation of innate and acquired immune response. In the milieu of IL-12 or IL-15, IL-18 is a potent inducer of IFN-gamma in natural killer (NK) cells and CD4 T helper (Th) 1 lymphocytes. However, IL-18 also modulates Th2 and Th17 cell responses, as well as the activity of CD8 cytotoxic cells and neutrophils, in a host microenvironment-dependent manner. IL-18 is a cytokine that stimulates various cell types and has pleiotropic functions. Recently, IL-18 has also been shown to execute specific effects in pancreatic diseases, including acute and chronic pancreatitis, as well as pancreatic cancer.
Reference:
1.Acta Biochim Pol 2016;63(1):59-63. doi: 10.18388/abp.2015_1153. 2.Epub 2016 Feb 17. 2. Int J Mol Sci 2019 Feb 2;20(3):649. doi: 10.3390/ijms20030649
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
MECR Proteinsite
Integrin alpha M beta 2 Proteinweb
Popular categories:
Checkpoint Kinase 1 (Chk1)
Cyclin-Dependent Kinase 3 (CDK3)
