Share this post on:

Name:
EGF Protein

Synonyms:
Pro-epidermal growth factor, Epidermal growth factor, EGF

Species Name:
Rat

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P07522

Gene Id:
N974-R1026NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR

Molecular Weight:
6kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM PB, 100mM NaCl, pH6.0

Quality Statement:
Epidermal growth factor (EGF) has been localized in human salivary and Brunner’s glands and found to stimulate the proliferation of gastrointestinal and pancreatic tissues in animals, is a single polypeptide of 53 amino acid residues which is involved in the regulation of cell proliferation. EGF exerts its effects in the target cells by binding to the plasma membrane located EGF receptor. And The EGF receptor is a transmembrane protein tyrosine kinase. EGF is also a peptide which effects the growth and/or differentiated functions of many cell types. Several pieces of evidence indicate that EGF and its receptor may play a role in carcinogenesis.

Reference:
1.Int J Pancreatol. 1992 Aug;12(1):23-9. doi: 10.1007/BF02927067​. 2.Cell Biol Int. 1995 May;19(5):413-30. doi: 10.1006/cbir.1995.1086​. 3.J Cell Biochem. 1986;31(2):135-52. doi: 10.1002/jcb.240310206​.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD83 Proteinweb
Transferrin Proteincustom synthesis
Popular categories:
IL-23
Integrin alpha L beta 2

Share this post on:

Author: Adenosylmethionine- apoptosisinducer