Name:
IL-3 Protein
Synonyms:
IL3, MCGF, MGC79398, MGC79399, MULTI-CSF, Interleukin-3
Species Name:
Rat
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P04823
Gene Id:
Ser28-Cys166 MSDRGSDAHHLLRTLDCRTIALEILVKLPVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC
Molecular Weight:
16kDa (Reducing)
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
20mM PB, 200mM NaCl, pH6.0
Quality Statement:
IL3 (interleukin 3), also known as IL-3, is a potent growth-promoting cytokine that belongs to the IL-3 family. Interleukin-3 is a cytokine that regulates the proliferation, differentiation, activation, and survival of myeloid progenitor cells and the mast cells, eosinophils, basophils, neutrophils, monocytes, megakaryocytes, and erythroid cells that they give rise to (1–3). Although IL-3 was first defined as a CSF (multi-CSF), it is not essential to hemopoiesis, and it may function in vivo pre dominantly as a proinflammatory cytokine activating mature myeloid cells. The IL-3 gene exists within a one megabase conserved cytokine gene cluster that also contains the genes for IL-4, IL-5, IL-13, and GM-CSF. IL3/IL-3 has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders.
Reference:
1.Gröger M. (2004) IL-3 induces expression of lymphatic markers Prox-1 and podoplanin in human endothelial cells. J Immunol. 173(12):7161-7169. 2.Hawwari A. (2002) The human IL-3 locus is regulated cooperatively by two NFAT-dependent enhancers that have distinct tissue-specific activities. J Immunol. 169(4): 1876-1886.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
DDR2 ProteinPurity & Documentation
MFAP3 ProteinSynonyms
Popular categories:
IL-36 alpha
PDGF
