Share this post on:

Name:
GDNF Protein

Synonyms:
ATF; HFB1-GDNF; HGDNF; HSCR3

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P39905

Gene Id:
Ser78-Ile211 SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Weight:
16kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris,500mM NaCl,1mEDTA pH8.5

Quality Statement:
GDNF and the GDNF-family ligands artemin, neurturin and persephin belong to the transforming growth factor-β (TGF-β) superfamily. The TGF-β superfamily represents a collection of multifunctional cytokines, including the neurotrophin family. Although GDNF shows only limited amino-acid sequence homology with the other members of the superfamily, it has significant conformational similarity as they all have the characteristic cysteine knot structural motif with the formation of three disulphide bonds. This family of proteins all function as homodimers and show protective and restorative effects in the developing and adult central nervous system (CNS). The neurotrophic effects of GDNF appear to be dependent on the presence of TGF-β in both in vivo and in vitro studies. GDNF was originally isolated from the supernatant of a rat glioma cell-line, and found to have pronounced effects on the survival of midbrain dopaminergic neurons. It has a relatively high specificity for dopaminergic neurons and thus has significant potential for the treatment of PD, which is predominantly characterised by progressive depletion of midbrain dopaminergic cell populations. Subsequently, GDNF has also been found to have trophic and protective effects on noradrenergic neurons in the locus coeruleus, as well as peripheral motor neurons, raising hopes for its therapeutic potential in HD and ALS.

Reference:
1.\tShelley J Allen (2013) Pharmacol Ther. 138(2):155-75.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TMED1 Proteinweb
HSPA5/GRP-78 Proteinmanufacturer
Popular categories:
Caspase-11
CD59

Share this post on:

Author: Adenosylmethionine- apoptosisinducer