CD300b/LMIR5/CD300LB Protein | Adenosylmethionine

Name:
CD300b/LMIR5/CD300LB Protein

Synonyms:
CD300b Protein, Human; CLM-7 Protein, Human; CLM7 Protein, Human; CMRF35-A2 Protein, Human; IREM-3 Protein, Human; IREM3 Protein, Human; TREM-5 Protein, Human; TREM5 Protein, Human

Species Name:
Mouse

Label Name:
null

Marker Name:
Unconjugated

Accession:
Q3U497

Gene Id:
Ile18-Tyr157IQGPALVRGPEQGSVTVQCRYSSRWQTNKKWWCRGASWSTCRVLIRSTGSEKETKSGRLSIRDNQKNHSFQVTMEMLRQNDTDTYWCGIEKFGTDRGTRVKVNVYSVGKDTMSTSNQLPWPTVDGSTDMVSSDLQKRTYYGGGSGGGSPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Weight:
52-64kDa (Reducing)

Purity:
＞95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4, 5% trehalose

Quality Statement:
The CD300 receptor family members are a group of molecules that modulate a variety of immune cell processes. The CD300 receptor family consists of members with activating and inhibitory capabilities mainly expressed on the surface of immune cells. LMIR5, also known as CD300b, CD300LB, CLM-7, and IREM-3, is a glycoprotein member of the immunoglobulin superfamily. Human LMIR5 consists of a 134 amino acid (aa) extracellular domain (ECD) with one Ig-like V-type domain, a 21 amino acid (aa) transmembrane segment, and a 29 aa cytoplasmic domain. Studies have shown that CD300b recognizes PS as a ligand and regulates phagocytosis of apoptotic cells through DAP12 signaling pathway.

Reference:
1.Journal List Cell Death Differ v.21(11); 2014 Nov PMC4211373.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PTS ProteinSynonyms
T-PA Proteinmanufacturer
Popular categories:
FGFR-1/CD331
Ubiquitin-Specific Peptidase 19

Author: Adenosylmethionine- apoptosisinducer

Related Posts