NTB-A/SLAMF6 Protein | Adenosylmethionine

Name:
NTB-A/SLAMF6 Protein

Synonyms:
NTB-A, SLAMF6, Ly108, NK-T-B-antigen, CD352, KALI

Species Name:
Human

Label Name:
His Tag

Marker Name:
null

Accession:
Q96DU3-1

Gene Id:
Gln22-Met226 QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMGGGSHHHHHHHH

Molecular Weight:
33-43kDa (Reducing)

Purity:
＞95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
1*PBS, pH7.4, 5% trehalose

Quality Statement:
SLAM family member 6, also known as Activating NK receptor, NK-T-B-antigen, NTB-A, SLAMF6, KALI and Ly18, is a single-pass type I membrane protein that belongs to the CD2 subfamily of the immunoglobulin superfamily. SLAMF6-related genes is located within a 400–500 kilobase (kb) genomic segment on chromosome 1 in humans and mice. The genes that encode the SLAM family were created by serial gene duplication. SLAMF6 / Ly18 contains one Ig-like (immunoglobulin-like) domain. It is expressed by all (resting and activated) natural killer cells (NK), T- and B-lymphocytes. SLAMF6 / Ly18 triggers cytolytic activity only in natural killer cells (NK) expressing high surface densities of natural cytotoxicity receptors. SLAMF6 / Ly18 is a homodimer. It interacts with PTN6 and, upon phosphorylation, with PTN11 and SH2D1A/SAP. It may function as a coreceptor in the process of NK cell activation. SLAMF6 / Ly18 can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients.

Reference:
1. Rietdijk, Keszei, Castro, Terhorst, Abadía-Molina (2023) Characterization of Ly108-H1 Signaling Reveals Ly108-3 Expression and Additional Strain-Specific Differences in Lupus Prone Mice. Int J Mol Sci (IF: 5.6) 24(5).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IGF-I R ProteinMedChemExpress
ACE2 Proteinmanufacturer
Popular categories:
Angiopoietin-Like 8
NEK7

Author: Adenosylmethionine- apoptosisinducer

Related Posts