GDF-5/BMP-14 Protein | Adenosylmethionine

Name:
GDF-5/BMP-14 Protein

Synonyms:
BMP14, CDMP1, LAP-4, LPS-associated protein 4

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P43026

Gene Id:
Ala382-Arg501MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Molecular Weight:
28kDa (Non-reducing)

Purity:
＞95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
50mM HAc, pH2.9

Quality Statement:
Human growth differentiation factor 5 (GDF5) is one of the bone morphogenetic proteins (BMPs) belonging to the transforming growth factor β (TGF-β) superfamily. It has commercial value as a therapeutic protein because of its ability to induce cartilage and bone formation, and angiogenesis in adult animals. This protein regulates the development of numerous tissue and cell types, including cartilage, joints, brown fat, teeth, and the growth of neuronal axons and dendrites. Mutations of GDF5 are associated with several human and animal diseases that are characterized by skeletal deformity such as short digits and short limbs.

Reference:
Jin L, Li X. Growth differentiation factor 5 regulation in bone regeneration. Curr Pharm Des. 2013;19(19):3364-73. doi: 10.2174/1381612811319190003. PMID: 23432680.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
MAdCAM1 Proteinsupplier
CD47 ProteinSource
Popular categories:
CD1d
SARS-CoV-2 Spike Proteins

Author: Adenosylmethionine- apoptosisinducer

Related Posts