Share this post on:

Name:
Biotinylated CD79B Protein

Synonyms:
CD79b, B29, IGB, Ig-beta

Species Name:
Human

Label Name:
null

Marker Name:
Unconjugated

Accession:
P40259-1

Gene Id:
Ala29-Asp159 ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE

Molecular Weight:
55-60 kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
CD79, the signaling component of the B-cell receptor (BCR), is a promising target of antibodies and ADCs for the treatment of B-cell malignancies and autoimmune diseases. CD79 is a heterodimer, consisting of CD79a and CD79b, and is an attractive target because it is B cell specific and is expressed in almost all forms of non-Hodgkin’s lymphoma and most forms of chronic lymphocytic leukemia. CD79 is particularly attractive for use as an ADC because the receptor is trafficked to a lysosome-like compartment as part of antigen presentation, thereby providing a mechanism for enhancing the release of drug from the ADC.

Reference:
1. Dr Maria Corinna A Palanca-Wessels, Prof Myron Czuczman, Prof Gilles Salles, Sarit Assouline, Laurie H Sehn, Ian Flinn, et al; Safety and activity of the anti-CD79B antibody–drug conjugate polatuzumab vedotin in relapsed or refractory B-cell non-Hodgkin lymphoma and chronic lymphocytic leukaemia: a phase 1 study. ARTICLES| VOLUME 16, ISSUE 6, P704-715, JUNE 2015..

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
FKBP11 Proteinsupplier
RCN2 Proteinmanufacturer
Popular categories:
Cadherin-15
Siglec-15

Share this post on:

Author: Adenosylmethionine- apoptosisinducer