Share this post on:

Name:
VEGF-121 Protein

Synonyms:
Vascular Endothelial Growth Factor A, VEGFA

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P15692-9

Gene Id:
Ala27-Arg147 MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR.

Molecular Weight:
14kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM PB, 150mM NaCl, pH 7.4

Quality Statement:
VEGF-121, an abundant splicing isoform of vascular endothelial growth factor (VEGF), exists as a disulfide-linked homodimer. It induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Contrast to other isoforms, VEGF-121 has very little affinity for heparin-sulfate proteoglycans, without recruiting Neuropilin1-expressing monocytes (NEMs), conferring to VEGF-121 the ability to diffuse freely, and increase tumor growth rate in vivo.

Reference:
1.\tFASEB J. 2001 Jul;15(9):1667-9.doi: 10.1096/fj.00-0757fje.2.\tCancer Gene Ther. 2016 May;23(5):125-32. doi: 10.1038/cgt.2016.12. Epub 2016 Apr 1.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
ACBD7 Proteinmanufacturer
DPEP1 Proteinmanufacturer
Popular categories:
Membrane Cofactor Protein/CD46
BTN2A1

Share this post on:

Author: Adenosylmethionine- apoptosisinducer