Name:
Biotinylated TIM-3/HAVCR2 Protein
Synonyms:
TIMD3, FLJ14428, KIM3
Species Name:
Mouse
Label Name:
null
Marker Name:
null
Accession:
Q8VIM0-1
Gene Id:
Leu22-Arg191LENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIRGGGSHHHHHHHHGLNDIFEAQKIEWHE
Molecular Weight:
35-55kDa (Reducing)
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4.
Quality Statement:
TIM-3 (T cell immunoglobulin and mucin domain-3), also known as HAVCR2, is a 60 kDa member of the TIM family of immune regulating molecules. TIMs are type I transmembrane glycoproteins with one Ig-like V-type domain and a Ser/Thr-rich mucin stalk region. Mature mouse TIM-3 consists of a 174 amino acid (aa) extracellular domain (ECD), a 21 aa transmembrane segment, and a 67 aa cytoplasmic tail. Within the ECD, mouse TIM-3 shares 58% and 75% aa sequence identity with human and rat TIM-3, respectively.Recently, the identification of Galectin-9 as a ligand for TIM-3 has established the TIM-3-Galectin-9 pathway as an important regulator of Th1 immunity and tolerance induction. Engagement of Tim-3 by its ligand Galectin-9 negatively regulates IFN-gamma secretion and influences the ability to induce T cell tolerance in both mice and man. The TIM-3-Galectin-9 pathway could underlie chronic autoimmune disease states, such as multiple sclerosis. Numerous studies have demonstrated that Tim-3 influences autoimmune diseases, including diabetes and multiple sclerosis, and its role in other inflammatory diseases including allergies and cancer is beginning to become clear. In the tumor rejection model, the soluble form of Tim-3 (sTim-3) significantly impaired T cell antitumor immunity, evidenced by decreased antitumor CTL activity and reduced amount of tumor-infiltrating lymphocytes in the tumor.
Reference:
1. Sakuishi, K. et al. (2011) Trends Immunol. 32:345.2. Anderson, A.C. (2012) Curr. Opin. Immunol. 24:213.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD133/PROM1 Proteinsupplier
KIR2DL3 ProteinStorage & Stability
Popular categories:
GnRH
Siglec-8