Share this post on:

Name:
Biotinylated GCGR/Glucagon Receptor Protein

Synonyms:
Glucagon R, GCGR,Glucagon receptor

Species Name:
Human

Label Name:
null

Marker Name:
null

Accession:
P47871

Gene Id:
Ala26-Lys136 AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKGGGSHHHHHHHHGLNDIFEAQKIEWHE

Molecular Weight:
30-43kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
The glucagon receptor (GCGR) is a Class B GPCR that has an important role in maintenance of glucose homeostasis and, as such, is considered to be a valuable target for the treatment of diabetes. The GCGR is widely expressed and can be found in the liver, adipose tissue, heart, kidney, pancreatic islets, stomach, small intestine, thyroid, and skeletal muscle. The GCGR is coupled to the activation of adenylate cyclase via Gs, with concomitant rise in cellular cyclic AMP levels and activation of protein kinase A (PKA). GCGR mRNA has been detected in islets. In vitro/ex vivo studies suggest that glucagon potentiates insulin secretion from isolated islets, although the potency is considerably less than that of the insulin secretagogue GLP-1. Mutations of the GCGR gene are associated with congenital noninsulin-dependent diabetes, and inhibition of GCGR in vivo lowers blood glucose and improves glucose tolerance in obese diabetic mice.

Reference:
1. Michelle L. Boland, Rhianna C. Laker, Karly Mather, Arkadiusz Nawrocki, Stephanie Oldham, Brandon B. Boland, Hilary Lewis, James Conway, Jacqueline Naylor, Silvia Guionaud, Michael Feigh, Sanne S. Veidal, Louise Lantier, Owen P. McGuinness, Joseph Grimsby, Cristina M. Rondinone, Lutz Jermutus, Martin R. Larsen, James L. Trevaskis & Christopher J. Rhodes: Resolution of NASH and hepatic fibrosis by the GLP-1R and GCGR dual-agonist cotadutide via modulating mitochondrial function and lipogenesis. Nature Metabolism volume 2, pages413–431 (2020).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TrkA Proteinmanufacturer
LIFR Proteinsupplier
Popular categories:
Integrin alpha 10 beta 1
Ubiquitin-Specific Peptidase 43

Share this post on:

Author: Adenosylmethionine- apoptosisinducer