Name:
IL-6 Protein
Synonyms:
Interleukin-6, IL-6;Interleukin-6, IL-6, B-Cell Hybridoma Growth Factor, Interleukin HP-1, Il6, Il-6；
Species Name:
Canine
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P41323
Gene Id:
Phe21-Met207MFPTPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDECVKHTTIHLILRSLEDFLQFSLRAVRIM
Molecular Weight:
24kDa
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
20mM Tris,80mM NaCl,pH8.0.
Quality Statement:
Interleukin-6 (IL-6) is a pro-inflammatory cytokine that also has an important role in immunity. Mouse IL-6 appears to be directly involved in the responses that occur after infection and injury and may prove to be as important as IL-1 in regulating the acute phase response. Mouse IL-6 is reported to be produced by fibroblasts, activated T cells, activated monocytes or macrophages, and endothelial cells. It acts upon a variety of cells, including fibroblasts, myeloid progenitor cells, T cells, B cells and hepatocytes. IL-6 has a wide variety of biological functions: it plays an essential role in the final differentiation of B-cells into Ig-secreting cells, it induces myeloma and plasmacytoma growth, nerve cells differentiation in hepatocytes, and acute phase reactants.
Reference:
1.Ferguson-Smith AC, Chen YF, Newman MS, et al. 1988. Genomics. 2:203-8. 2.van der Poll T, Keogh CV, Guirao X, et al. 1997. J Infect Dis. 176:439-44. 3.Ming JE, Cernetti C, Steinman RM, et al. 1989. J Mol Cell Immunol. 4:203-11; discussion 211-2. 4.Bastard JP, Jardel C, Delattre J, et al. 1999. Circulation. 99:2221-2. 5.Heinrich PC, Behrmann I, Muller-Newen G, et al. 1998. Biochem J. 334 ( Pt 2):297-314. 6.Van Snick J, Cayphas S, Szikora JP, et al. 1988. Eur J Immunol. 18:193-7.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Carbonic Anhydrase VIII/CA8 Proteincustom synthesis
Chk1 Proteinsite
Popular categories:
Protein tyrosine phosphatases
Serpin B6
