Share this post on:

Name:
Biotinylated ICAM-1/CD54 Protein

Synonyms:
BB2, ICAM1, CD54, P3.58

Species Name:
Human

Label Name:
null

Marker Name:
null

Accession:
P05362-1

Gene Id:
Gln28-Glu480QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEGGGSHHHHHHHHGLNDIFEAQKIEWHE

Molecular Weight:
72-90kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
ICAM-1 is a cell surface glycoprotein expressed at a low basal level in immune, endothelial (EC) and epithelial cells, but is up-regulated in response to inflammatory stimulation. The function of ICAM-1 has been best studied in leukocyte transendothelial migration (TEM), where ICAM-1 regulates leukocyte rolling and adhesive interactions with the vessel wall, and guides leukocyte crossing of the endothelial layer. More recently, functional studies identified several new roles of ICAM-1 in epithelial injury-resolution responses, innate and adaptive immune responses in inflammation, and tumorigenesis.

Reference:
1. Theresa N. Ramos; Daniel C. Bullard; Scott R. Barnum:ICAM-1: Isoforms and Phenotypes, J Immunol (2014) 192 (10): 4469–4474.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GM-CSF ProteinFormulation
IL-2R alpha ProteinGene ID
Popular categories:
Jagged-2
Glycophorin-A/CD235a

Share this post on:

Author: Adenosylmethionine- apoptosisinducer