CD300c/LMIR2 Protein | Adenosylmethionine

Name:
CD300c/LMIR2 Protein

Synonyms:
CD300c antigenCMRF35 antigen; CD300c molecule; CD300c; CLM6; CLM-6; CMRF35 leukocyte immunoglobulin-like receptor; CMRF35; CMRF-35; CMRF35A leukocyte immunoglobulin-like receptor; CMRF-35A; CMRF35ACMRF35A1; CMRF35CMRF35-A1; CMRF35-like molecule 6; IGSF16 ; IgSF16; IGSF16CD300 antigen-like family member C; Immunoglobulin superfamily member 16; LIR

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
Q08708

Gene Id:
Met29-Arg183MTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRGGGSHHHHHHHH

Molecular Weight:
30-45kDa (Reducing)

Purity:
＞95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
CMRF-35-like molecule-6 (CLM-6), known as LMIR8, CMRF-35A1, and CD300c, is a type I transmembrane glycoprotein belonging to the immunoregulatory signaling (IRS) family of immunoglobulin-like molecules. A charged amino acid residue in the transmembrane domain of CD300c/CLM-6, found in additional family members CLM‑2, CLM-4, CLM-5, and CLM-7, enables interactions with adapter proteins. CD300c has been shown to be a FcR gamma -coupled receptor that is selectively expressed in Plasmacytoid dendritic cells (pDCs). CD300c signals might negatively regulate the activation of pDCs in response to viral infections. Additional research into CD300 receptor function during viral infections could help develop novel anti-viral therapies.

Reference:
1.Clark, G.J. et al. (2001) Tissue Antigens 57:415.2.Borrego F. (2013) Blood 121:1951.3.Vitallé J. et al. (2019) Eur J Immunol. 49(3):364.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
FcRH5/FcRL5 ProteinBiological Activity
Phospholipase C ProteinFormulation
Popular categories:
Alpha-1 Antitrypsin 1-4
CD34

Author: Adenosylmethionine- apoptosisinducer

Related Posts