Share this post on:

Name:
IL-18 Protein

Synonyms:
IGIF, IL-18, IL1F4

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P70380

Gene Id:
Asn36-Ser192NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Molecular Weight:
18kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 150mM NaCl, pH8.0

Quality Statement:
Interleukin 18 (IL-18) is a pleiotropic cytokine involved in the regulation of innate and acquired immune response. In the milieu of IL-12 or IL-15, IL-18 is a potent inducer of IFN-gamma in natural killer (NK) cells and CD4 T helper (Th) 1 lymphocytes. However, IL-18 also modulates Th2 and Th17 cell responses, as well as the activity of CD8 cytotoxic cells and neutrophils, in a host microenvironment-dependent manner. IL-18 is a cytokine that stimulates various cell types and has pleiotropic functions. Recently, IL-18 has also been shown to execute specific effects in pancreatic diseases, including acute and chronic pancreatitis, as well as pancreatic cancer.

Reference:
Acta Biochim Pol 2016;63(1):59-63. doi: 10.18388/abp.2015_1153. Epub 2016 Feb 17. 2. Int J Mol Sci 2019 Feb 2;20(3):649. doi: 10.3390/ijms20030649.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Probetacellulin ProteinStorage & Stability
CTLA-4 Proteinsupplier
Popular categories:
Alpha-1 Antitrypsin 1-4
Neuregulins

Share this post on:

Author: Adenosylmethionine- apoptosisinducer