Share this post on:

Name:
CNTF Protein

Synonyms:
Ciliary neurotrophic factor

Species Name:
Rat

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P20294

Gene Id:
Ala2-Met200AFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM

Molecular Weight:
22kDa (Reducing)

Purity:
>95% by SDS-PAGE&RP HPLC

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM PB, 2mM TCEP, pH 7.5

Quality Statement:
Ciliary neurotrophic factor (CNTF) is a pluripotent neurotrophic factor originally isolated from chick embryo ciliary neurons. CNTF has potent effects on the development and maintenance of the nervous system, inducing neuronal survival and differentiation by stimulating gene expression of sensory, sympathetic and motor neurons. Ciliary neurotrophic factor (CNTF) is the most extensively studied member of the cytokine family that signal through intracellular chains of the gp130/LIFRβ receptor. A large body of evidence demonstrates that CNTF promotes rod photoreceptor survival in almost all animal models. Recent studies indicate that CNTF also promotes cone photoreceptor survival and cone outer segment regeneration in the degenerating retina and improves cone function in dogs with congenital achromotopsia.

Reference:
1.\tProg Retin Eye Res. 2012 Mar;31(2):136-51. doi: 10.1016/j.preteyeres.2011.11.005​. Epub 2011 Dec 10.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GRO-beta/CXCL2 Proteinsite
IL-18 ProteinFormulation
Popular categories:
ADAMTS14
Retinoic Acid Receptor-related Orphan Receptors

Share this post on:

Author: Adenosylmethionine- apoptosisinducer