Name:
TNF-α Protein
Synonyms:
TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a; Cachectin; DIF; TNFA; TNFSF2
Species Name:
Bovine
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
Q06599
Gene Id:
Leu78-Leu234LRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL
Molecular Weight:
17 kDa (Reducing)
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4.
Quality Statement:
TNF alpha is produced by various types of cells including macrophages, monocytes, neutrophils, T cells, and NK-cells.TNF-alpha is critical for normal immune response, abnormal secretion TNF alpha activates synovial fibroblasts, keratinocytes, osteoclasts, induces rheumatoid arthritis, inflammatory bowel disease, psoriatic arthritis (PsA), and noninfectious uveitis (NIU). TNF alpha positively regulates endogenous TNF-α expression levels independently of Pgp efflux activity, induces IHF cells proliferation. TNF alpha in tissues may promote cancer growth, invasion, and metastasis. Besides, TNF alpha stimulates NF-κB pathway via TNFR2 and anti-TNF-α MAb significantly suppresses the tumor development in colitis-associated cancer (CAC) mouse. TNF alpha as a proneurogenic factor activates the SAPK/JNK pathway and can facilitate neuronal replacement and brain repair in response to brain injury.
Reference:
1.Benyo DF. et al. (1992). Endocrinology. 130(2):854-60. 2.El-Tahan RR, et al. (2016). Springerplus.5(1):1508. 3.Jang DI, et al. (2021). Int J Mol Sci. 22(5):2719. 4.Berguetti T, et al. (2019). Cells. 8(5):500.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
15 Lipoxygenase 2 Proteinsupplier
CXCL8 Proteinsupplier
Popular categories:
DNGR-1/CLEC9A
Hepatitis C Virus Proteins
