Share this post on:

Name:
4-1BB/TNFRSF9 Protein

Synonyms:
TNFRSF9; 4-1BB; CD137; CDw137; ILA

Species Name:
Rabbit

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
G1SHD7

Gene Id:
Val29 -Ile191VQGPCANCPAGTFCGKSRNPIFVPCPPNSLSCGSGQRTCVLCRRCEGVFRTKKPCSPTSDTECECIAGFHCLGPGCSMCEQDCEQGQEFTKEGCKDCPFGSFNNQKGGICQPWTNCSGGRPVLVNGTKDSDVVCGPTAPGFSPGASSTTSPPPPPAGHSPQVIGGGSHHHHHHHH

Molecular Weight:
27-33kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
CD137 (also known as 4-1BB) is a surface co-stimulatory glycoprotein originally described as present on activated T lymphocytes, which belongs to the tumor necrosis factor (TNF) receptor superfamily. CD137 can be expressed by activated T cells, but to a larger extent on CD8 than on CD4 T cells. In addition, CD137 expression is found on dendritic cells, follicular dendritic cells, natural killer cells, granulocytes and cells of blood vessel walls at sites of inflammation. The best characterized activity of CD137 is its costimulatory activity for activated T cells. 4-1BB signaling either by binding to 4-1BBL or by antibody ligation delivers signals for T-cell activation and growth, as well as monocyte proliferation and B-cell survival, and plays an important role in the amplification of T cell-mediated immune responses.

Reference:
Melero I, et al. (2008) Multi-layered action mechanisms of CD137 (4-1BB)-targeted immunotherapies. Trends Pharmacol Sci. 29(8): 383-90.Thum E, et al. (2009) CD137, implications in immunity and potential for therapy. Front Biosci. 14: 4173-88.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
MeCP2 ProteinFormulation
TAGLN2Species
Popular categories:
Serine/Threonine Kinase Proteins
CPA4

Share this post on:

Author: Adenosylmethionine- apoptosisinducer