IL-10 Protein | Adenosylmethionine

Name:
IL-10 Protein

Synonyms:
IInterleukin-10; IL-10; Cytokine synthesis inhibitory factor; CSIF; IL10; RP11-262N9.1; IL10A; MGC126450; MGC126451; TGIF

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P22301

Gene Id:
Ser19-Asn178MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Molecular Weight:
16kDa (Reducing)

Purity:
＞95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to-70 °C as supplied. ·1 month, 2 to 8 °C under sterileconditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH 7.4

Quality Statement:
Interleukin 10(IL10), also known as cytokinesynthesis inhibitory factor (CSIF),is a secreted protein and belongs to theIL-10 family. IL-10 is secreted by many activated hematopoietic cell types aswell as hepatic stellate cells, keratinocytes, and placental cytotrophoblasts .IL-10 is an anti-inflammatory TH2 cytokine that has a critical role in limitingthe immune response to pathogens to prevent host damage. As IL-10 in producedin several T helper populations, it is proposed that it provides a feedbackloop to limit the effector functions of macrophages and DCs on T cells. Onceexpressed, IL-10 signals through the IL-10 receptor (IL-10R) to activate STAT3.As IL-10 is a strong inhibitor of inflammation, it has become a viablebiomarker for various diseases and conditions as well as a therapeutic moleculefor certain conditions. In addition to elevated levels in parasitic infection,high expression levels of IL-10 are also found in retroviral infectionsinducing immunodeficiency. The immunosuppressive properties of IL-10 suggest apossible clinical use of IL-10 in suppressing rejections of grafts after organtransplantations.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD44 Protein
APP/Protease Nexin-II Protein
Popular categories:
IL-16
Caspase-10

Author: Adenosylmethionine- apoptosisinducer

Related Posts