Name:
IL-2 Protein
Synonyms:
Interleukin-2蛋白；IL-2蛋白;aldesleukin; interleukin 2; interleukin-2; IL-2; IL2; T-cell growth facter; T cell growth factor; TCGF ; REF: C1025
Species Name:
Mouse
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P04351
Gene Id:
MAPTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRMLTFKFYLPKQA TELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDNTFECQFDDESATV VDFLRRWIAFCQSIISTSPQ
Molecular Weight:
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Stability Storage:
Lyophilized protein should be stored at
Buffer System:
Lyophilized from a 0.2 μm filtered solution of 20mM Sodium Citrate, 0.2%Tween 80,pH3.0.
Quality Statement:
Interleukin 2 (IL 2), also termed T-cell growth factor, is a member of the cytokine family which includes IL-4, IL-7, IL-9, IL-15 and IL-21. Each member of this family has a four alpha helix bundle. IL-2 signals through the IL-2 receptor, a complex consisting of tree subunits, termed alpha, beta and gamma. The IL-2 R gamma is shared by cytokine receptors of all members of cytokine family. Mature mouse IL2 shares 56% and 73% aa sequence identity with human and rat IL2, respectively. IL-2 is produced by CD4+ T cell, CD8+ T cells, gamma δ T cells, B cells, dendritic cells and eosinophils, and plays a vital role in key function of the immune system, tolerance and immunity, primarily via its potent stimulatory activity for T cells.Thus, IL2 may be a key cytokine in the natural suppression of autoimmunity.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
BACE1 Protein
IGFBP-2 Protein
Popular categories:
SARS-CoV-2 N Protein (NP)
Siglec-11
