4-1BB/TNFRSF9 Protein | Adenosylmethionine

Name:
4-1BB/TNFRSF9 Protein

Synonyms:
T-cell antigen ILA，ILA，4-1BB Ligand Receptor，CD137 Antigen，CDw137，CD137，Interleukin-Activated Receptor， Homolog Of Mouse Ly63，Tumor Necrosis Factor Receptor Superfamily， Member 9，Homolog Of Mouse 4-1BB，Receptor Protein 4-1BB，T Cell Antigen ILA

Species Name:
Rat

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
Q4W8J3

Gene Id:
Thr24-Gln187TRNPCDSCEAGTFCSKYPPVCTSCPPSTYSSTGGQPNCDICRVCQGYFRFKKPCSSTHNAECECVEGFHCLGPKCTRCEKDCRPGQELTEQGCKNCGLGTFNDQDGAGVCRPWTNCSLDGRSVLKNGTKEKDVVCGPPVVSLSPSTTPSAVTTPERESGERPLQGGGSHHHHHHHH

Molecular Weight:
28-40kDa (Reducing)

Purity:
＞95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
CD137 (also known as 4-1BB) is a surface co-stimulatory glycoprotein originally described as present on activated T lymphocytes, which belongs to the tumor necrosis factor (TNF) receptor superfamily. CD137 can be expressed by activated T cells, but to a larger extent on CD8 than on CD4 T cells. In addition, CD137 and CD137L are expressed in different human primary tumor tissues, suggesting that they may influence the progression of tumors. The best characterized activity of CD137 is its costimulatory activity for activated T cells.

Reference:
1. Melero I, et al. (2008) Multi-layered action mechanisms of CD137 (4-1BB)-targeted immunotherapies. Trends Pharmacol Sci. 29(8): 383-90. 2. Thum E, et al. (2009) CD137, implications in immunity and potential for therapy. Front Biosci. 14: 4173-88.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-17F Protein
IL-17A Protein
Popular categories:
Delta-like 1 (DLL1 )
Fc-gamma Receptor I/CD64

Author: Adenosylmethionine- apoptosisinducer

Related Posts