Share this post on:

Name:
NTB-A/SLAMF6 Protein

Synonyms:
NTB-A, SLAMF6, Ly108, NK-T-B-antigen, CD352, KALI

Species Name:
Human

Label Name:
Human Fc Tag

Marker Name:
Unconjugated

Accession:
Q96DU3-1

Gene Id:
Gln22-Met226 QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Weight:
60-72kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
NTB-A (NK-T-B-antigen), also known as Ly108 and SLAMF6, is a 60 kDa type I transmembrane glycoprotein that belongs to the SLAM subgroup of the CD2 family. Mature human NTB-A contains a 205 amino acid (aa) extracellular domain (ECD) with one Ig-like V-set and one Ig-like C2-set domain. It also contains a 21 aa transmembrane segment and an 84 aa cytoplasmic domain with two immunoreceptor tyrosine-based switch motifs (ITSMs). An alternately spliced isoform is truncated in the cytoplasmic domain and lacks the two ITSMs. NTB-A functions as an activating coreceptor on NK and T cells. Tyrosine phosphorylation in the membrane proximal ITSM enables specific association with EAT-2, an interaction that is required for NTB-A mediated cytotoxicity of NK cells.

Reference:
Veillette, A. (2006) Immunol. Rev. 214:22.Bottino, C. et al. (2001) J. Exp. Med. 194:235.Fraser, C.C. et al. (2002) Immunogenetics 53:843.Eissmann, P. and C. Watzl (2006) J. Immunol. 177:3170.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
DTD1 Protein
LIV-1/SLC39A6 Protein
Popular categories:
I-TAC/CXCL11
TNF Superfamily

Share this post on:

Author: Adenosylmethionine- apoptosisinducer