Name:
FGF-basic Protein
Synonyms:
FGF-2蛋白；FGFb蛋白;Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; Fgf2; Fgf-2
Species Name:
Mouse
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P15655
Gene Id:
Met1-Ser154MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQA EERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTG QYKLGSKTGPGQKAILFLPMSAKS
Molecular Weight:
Purity:
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
null
Reconstitution:
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Stability Storage:
Lyophilized protein should be stored at
Buffer System:
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 400mM NaCl, pH 7.0.
Quality Statement:
FGF basic is one of 22 mitogenic proteins of the FGF family, which show 35-60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. The 17 kDa mouse sequence has 98% aa identity with rat, and 95% identity with human, bovine, and sheep FGF basic. Binding of FGF to heparin or cell surface HSPG is necessary for binding, dimerization and activation of tyrosine kinase FGF receptors. FGF basic binds other proteins, polysaccharides and lipids with lower affinity. Expression of FGF basic is nearly ubiquitous but disruption of the mouse FGF basic gene gives a relatively mild phenotype, suggesting compensation by other FGF family members. FGF basic modulates such normal processes as angiogenesis, wound healing and tissue repair, embryonic development and differentiation, neuronal function and neural degeneration. Transgenic overexpression of FGF basic results in excessive proliferation and angiogenesis is reminiscent of a variety of pathological conditions.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
DDC Protein
TGF beta 2/TGFB2 Protein
Popular categories:
LIGHT Proteins
Peptide Hormone & Neuropeptides
