Name:
NKG2D/CD314 Protein
Synonyms:
Killer cell lectin-like receptor subfamily K member 1，NK cell receptor D，NKG2-D-activating NK receptor，CD314，D12S2489E，KLR，DNA Segment On Chromosome 12 (Unique) 2489 Expressed Sequence，Killer Cell Lectin Like Receptor K1，NKG2-D，Killer Cell Lectin-Like Receptor Subfamily K， Member 1，KLRK1，CD314 Antigen
Species Name:
Human
Label Name:
Human Fc Tag
Marker Name:
Unconjugated
Accession:
P26718-1
Gene Id:
Phe78-Val216MDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIEGRFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Molecular Weight:
50-70kDa (Reducing)
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4.
Quality Statement:
NKG2D is a type II transmembrane glycoprotein having an extracellular lectin-like domain. This domain lacks the recognizable calcium-binding sites found in true C-type lectins and binds protein rather than carbohydrate ligands. Human ligands for NKG2D include MICA, MICB, and ULBP1, 2, and 3. Expression of NKG2D ligands occurs in epithelial cells, tumor cells and under conditions of stress or infection. NKG2D exists as a disulfide-linked homodimer that delivers an activating signal upon ligand binding. Signaling requires association with an adapter protein. Alternative splicing of the NKG2D mRNA results in isoforms with different cytoplasmic domains that can associate either with DAP12 to deliver a true activating signal or with DAP10 resulting in a costimulatory signal. NKG2D has been implicated in anti-tumor surveillance and the immune response against viral infection. In NK cells, NKG2D serves as an activating receptor, which itself is able to trigger cytotoxicity. The function of NKG2D on CD8+ T cells is to send co-stimulatory signals to activate them.
Reference:
1.Cerwenka, A. et al. (2001) Proc. Natl. Acad. Sci. USA 98:11521.2.Diefenbach, A. et al. (2001) Nature 413:165.3.NKG2D and its Ligands (2002) www.rndsystems.com
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD300a/LMIR1 Protein
SPINK2 Protein
Popular categories:
Interferon Gamma Inducible Protein 16
IL-10
