MIG/CXCL9 Protein | Adenosylmethionine

Name:
MIG/CXCL9 Protein

Synonyms:
C-X-C motif chemokine 9, MIG, CXCL9, CMK, SCYB9

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P18340

Gene Id:
Thr22-Thr126MTLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT

Molecular Weight:
17kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Monokine induced by IFN-gamma (MIG; CXC chemokine ligand (CXCL)9) is important in T lymphocyte recruitment in organ transplantation. MIG/CXCL9 stimulate CD4 lymphocyte proliferation in a MHC class II-mismatched MLR and also increased the number of IFN-gamma-producing CD4 lymphocytes in ELISPOT. Neutralization of MIG/CXCL9 in MLR reduced T lymphocyte proliferation, IFN-gamma-inducible protein 10/CXCL10 and IFN-inducible T cell alpha chemoattractant/CXCL11 had similar effects on T lymphocyte proliferation. MIG/CXCL9 stimulated T lymphocyte proliferation in MHC class I and total MHC-mismatched MLRs. Neutralization of CXCR3 reduced MIG/CXCL9-induced T lymphocyte proliferation and the number of IFN-gamma-positive spots on ELISPOT. The proliferative effects of MIG/CXCL9 were mediated via an IL-2-independent pathway and were controlled by IFN-gamma.

Reference:
1.\tJ Immunol. 2004 Jun 15;172(12):7417-24. doi: 10.4049/jimmunol.172.12.7417. 2.\tExp Cell Res. 2021 Oct 15;407(2):112801. doi: 10.1016/j.yexcr.2021.112801. Epub 2021 Aug 27.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
ALK-7 Protein
CD69 Protein
Popular categories:
SARS-CoV-2 N Protein (NP)
Others

Author: Adenosylmethionine- apoptosisinducer

Related Posts