Name:
B7-H3/CD276 Protein
Synonyms:
B7-H3, CD276;B7H3, B7-H3, CD276 antigen, CD276 molecule, CD276, B7H34Ig-B7-H3, B7-H3B7 homolog 3, Costimulatory molecule
Species Name:
Human
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
Q5ZPR3-2
Gene Id:
LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPHHHHHHHHHH
Molecular Weight:
38-48 kDa(Reducing )
Purity:
＞95%, by SDS-PAGE under reducing conditions
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS pH7.2, 5% trehalose
Quality Statement:
B7 homolog 3 (B7-H3, CD276) is a member of the B7 family of cell surface ligands that regulate T cell activation and immune responses. B7-H3 protein contains two extracellular Ig-like V-type domains and two IgG-like C2-type domains, a transmembrane domain, and a short intracellular domain . Early research examining the biological process of B7-H3 suggested that B7-H3 is a positive regulator of T cell response . Subsequent research studies indicated that B7-H3 is a negative regulator of T cell response, and that the protein inhibits T cell proliferation . One possibility is that B7-H3 interacts with two distinct sets of receptors, resulting in seemingly opposite biological outcomes . B7-H3 is expressed by antigen presenting cells, activated T cells, and a few normal tissues, including placenta and prostate . Expression of B7-H3 is seen in several cancer types, including prostate, breast, colon, lung, and gastric cancers, and in endothelial cells from tumor associated vasculature.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CRISP-1 Protein
Serpin B1 Protein
Popular categories:
CCL25
Interferon alpha-B
