FABP3 Protein | Adenosylmethionine

Name:
FABP3 Protein

Synonyms:

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
P05413

Gene Id:
MHHHHHHVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Molecular Weight:
15.7 kDa(Reducing)

Purity:
＞95%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<2EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Fatty acid-binding protein 3 (FABP3) is a cytosolic protein found in various tissues, including heart, skeletal muscle, intestinal mucosa, liver, and kidney. It is also highly expressed in the adult brain, particularly in the pons, frontal lobe, and hippocampus. In the brain, FABP3 regulates the lipid composition of the membrane and transports fatty acids between different intracellular compartments. It is released extracellularly after neuronal damage and high cerebrospinal fluid (CSF) concentration of FABP3 is found in acute conditions, such as brain injury and stroke. CSF FABP3 concentration is also higher in conditions with neuro degeneration/neuronal damage, e.g., Alzheimer’s disease (AD), mild cognitive impairment (MCI) due to AD, dementia with Lewy bodies, and Creutzfeldt–Jakob disease. CSF FABP3 concentration correlates with cognitive decline and are associated with brain volume loss in areas selectively affected in early AD. Thus, FABP3 is suggested to be a general marker of neuronal damage.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CSF1R Protein
PD-L1 Protein
Popular categories:
Carbonic Anhydrase 8 ( CA-VIII)
BMP Receptor Type II

Author: Adenosylmethionine- apoptosisinducer

Related Posts