AITRL Protein | Adenosylmethionine

Name:
AITRL Protein

Synonyms:
AITRL, Activation-induced TNFR member Ligand, TNFSF18, GITRL,TL-6

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
Q7TS55

Gene Id:
Thr47-Ser173TAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS

Molecular Weight:
14.5kD

Purity:
＞95% by SDS-PAGE & RP-HPLC

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM PB, 150mM NaCl, pH6.0

Quality Statement:
Activation-Inducible TNF-Related Ligand (AITRL), also known as Glucocorticoid-induced tumor necrosis factor receptor (TNFR) family-related protein (GITR), is a type I transmembrane protein that belongs to the TNF receptor superfamily. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells. GITR–GITRL cross-linking costimulated native and activated T cells and resulted in MAPK activation. Researches have indicated that GITRL could promote Th17 cell differentiation by p38 MAPK and STAT3 signaling in autoimmune arthritis.

Reference:
1.\tLi L, Wen W, Jia R, Li Y, Liu X, Sun X, Li Z. GITRL is associated with increased autoantibody production in patients with rheumatoid arthritis. Clin Rheumatol. 2016 Sep;35(9):2195-202. doi: 10.1007/s10067-016-3280-3. Epub 2016 Apr 21. PMID: 27098050. 2.\tTang X, Tian J, Ma J, Wang J, Qi C, Rui K, Wang Y, Xu H, Lu L, Wang S. GITRL modulates the activities of p38 MAPK and STAT3 to promote Th17 cell differentiation in autoimmune arthritis. Oncotarget. 2016 Feb 23;7(8):8590-600. doi: 10.18632/oncotarget.6535. PMID: 26657118; PMCID: PMC4890989.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
EPCR Protein
PCSK9 Protein
Popular categories:
G Protein-coupled Receptor Kinase 6 (GRK6)
Fas Ligand (FasL)

Author: Adenosylmethionine- apoptosisinducer

Related Posts