Share this post on:

Name:
KGF/FGF-7 Protein

Synonyms:
Heparin-binding growth factor 7 (HBGF-7), Keratinocyte growth factor (KGF)

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P36363

Gene Id:
Cys32-Thr194 CNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT

Molecular Weight:
20kDa (Reducing)

Purity:
>95% by SDS-PAGE&HPLC

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Keratinocyte growth factor (KGF), also known Fibroblast growth factor 7 (FGF-7) is a member of the fibroblast growth factor (FGF) family, and plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. KGF is also a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblast and endothelial cells. Studies of mouse and rat homologous protein implicated roles in morphogenesis of epithelium, re-epithelialization of wounds, hair development and early lung organogenesis.

Reference:
1.MacDonald KP, Hill GR. Keratinocyte Growth Factor (KGF) in hematology and oncology. Curr Pharm Des. 2002;8(5):395-403. doi: 10.2174/1381612023396104​. PMID: 12069377.2.Niu J, Chang Z, Peng B, Xia Q, Lu W, Huang P, Tsao MS, Chiao PJ. Keratinocyte growth factor/fibroblast growth factor-7-regulated cell migration and invasion through activation of NF-kappaB transcription factors. J Biol Chem. 2007 Mar 2;282(9):6001-11. doi: 10.1074/jbc.M606878200​. Epub 2007 Jan 2. PMID: 17200110.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SARS-CoV-2 S1 Protein (HEK293
Kallikrein-2 Protein
Popular categories:
Insulin-like Growth Factor 2 R
Death Receptor 3

Share this post on:

Author: Adenosylmethionine- apoptosisinducer