Share this post on:

Name:
IGF-I Protein

Synonyms:
IGF-I Protein, IGF1A Protein, IGFI Protein

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P07455

Gene Id:
Gly50-Ala119MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Weight:
8-9kDa (Non-Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
50mM NaAc, pH6.0.

Quality Statement:
Insulin-like growth factor 1 (IGF-1) is also known as somatomedin C,IGF1A, IGFI, sulfation factor, and is a hormone similar in molecular structureto Insulin. IGF-1 Protein binds to cell surface receptor IGF type 1 receptor,which abbreviated as \”IGF1R\” and modulates growth in many tissues,such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle,endothelium, and bone. IGF-1 Protein also mediates neuroprotective mechanism.It is produced primarily by the liver as an endocrine hormone as well as intarget tissues in a paracrine/autocrine fashion. IGF-1 consists of 70 aminoacids in a single chain with three intramolecular disulfide bridges. IGF-1 hasa molecular weight of 7649 daltons.

Reference:
1.Jansen M., et al.(1983)Sequence of cDNA encoding human Insulin-like growth factor I precursor. Nature306:609-611.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TWSG1 Protein
Glypican-3/GPC3 Protein
Popular categories:
IL-3R alpha/CD123
Small Ubiquitin Like Modifier 3

Share this post on:

Author: Adenosylmethionine- apoptosisinducer