Share this post on:

Name:
Betacellulin Protein

Synonyms:
Betacellulin, BTC

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P35070

Gene Id:
Asp32-Tyr111DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY

Molecular Weight:
12-16kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Betacellulin (BTC) is a member of the epidermal growth factor (EGF) family. Betacelluli is expressed in most tissues including kidney, uterus, liver and pancreas. It is also present in body fluids, including serum, milk, and colostrum. It is synthesized primarily as a transmembrane precursor, which is then processed to a mature molecule by proteolytic events. Betacellulin signals through the EGF receptor.

Reference:
1、Yamamoto K. et al. (2000) Recombinant human Betacellulin promotes the neogenesis of\u0002β-Cells and ameliorates glucose intolerance in mice with diabetes induced by selective alloxan perfusion. Diabetes. 49(12): 2021-2027.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GDF-15 Protein
Deoxyhypusine synthase/DHS Protein
Popular categories:
TIGIT Protein
PDGF-AB

Share this post on:

Author: Adenosylmethionine- apoptosisinducer