Name:
PD-L1/B7-H1 Protein
Synonyms:
PD-L1, B7-H1, CD274, PDCD1L1, PDCD1LG1
Species Name:
Cynomolgus
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
G7PSE7
Gene Id:
Phe19-Arg238, with C-terminal 8*His FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFVHGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLLNVTSTLRINTTANEIFYCIFRRLDPEENHTAELVIPELPLALPPNERGGGSHHHHHHHH
Molecular Weight:
32-40kDa
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4
Quality Statement:
Programmed death ligand 1 (PD-L1) belongs to the B7 series and is a 33-kDa type 1 transmembrane glycoprotein that contains 290 amino acids with Ig-V and IgC domains in its extracellular region. PD-L1 expression can be detected on hematopoietic cells including T cells, B cells, macrophages, dendritic cells (DCs), and mast cells, and non-hematopoietic healthy tissue cells including vascular endothelial cells, keratinocytes, pancreatic islet cells, astrocytes, placenta syncytiotrophoblast cells, and corneal epithelial and endothelial cells. PD-L1 is an essential immune checkpoint protein that binds to programmed death 1 (PD-1) on T-lymphocytes. Engagement of PD-1 by PD-L1 alters the activity of T cells in many ways, inhibiting T cell proliferation, survival, cytokine production, and other effector functions. T cell plays a critical role in killing cancer cells while the cancer cell exhibits immune escape by the expression of PD-L1. The binding of PD-L1 to PD-1 inhibits T cell proliferation and activity, leading to tumor immunosuppression.
Reference:
1、Salih H R. et al. (2006) The role of leukemia-derived B7-H1 (PD-L1) in tumor-T-cell interactions in humans. Exp Hematol. 34(7): 888-894.2、Wilcox R A. et al. (2009) B7-H1 (PD-L1, CD274) suppresses host immunity in T-cell lymphoproliferative disorders. Blood. 114(10): 2149-2158.3、Ruggiero A. et al. (2009) Crystal structure of PD-L1, a ribosome inactivating protein from Phytolacca dioica L. leaves with the property to induce DNA cleavage. Biopolymers. 91(12): 1135-1142.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PCBP1 Protein
KGF/FGF-7 Protein
Popular categories:
Activin/Inhibins Receptor
Translocases (EC 7)