FGF-10 Protein | Adenosylmethionine

Name:
FGF-10 Protein

Synonyms:
FGF-10, Fibroblast Growth Factor-10, FGFA, Keratinocyte growth factor-2, KGF2

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
O35565

Gene Id:
Ser62-Thr209MSSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT

Molecular Weight:
17kDa

Purity:
>95% by SDS-PAGE & RP-HPLC

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 50mM NaCl, 2mM DTT, pH8.0

Quality Statement:
Fibroblast growth factor 10 (FGF-10), a secreted heparin-binding protein, is a member of the fibroblast growth factor (FGF) family and is also known as Keratinocyte Growth Factor-2 (KGF-2). FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF-10 exhibits mitogenic activity for keratinizing epidermal cells, but essentially no activity for fibroblasts, which is similar to the biological activity of FGF7. Studies revealed that genetic variants of FGF10 were associated with extreme myopia in adults.

Reference:
1、Hubert F. et al. (2022) FGF10 promotes cardiac repair through a dual cellular mechanism increasing cardiomyocyte renewal and inhibiting fibrosis. Cardiovasc Res. 118(12): 2625-2637.2、Sun W. et al. (2019) Cytokine fibroblast growth factor 10 (FGF10) polymorphisms are associated with risk of myopia in young children. J Cell Biochem. 120(9): 15241-15247.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
FCGRT Protein
FGF-4 Protein
Popular categories:
Ubiquitin-Specific Peptidase 37
CD133

Author: Adenosylmethionine- apoptosisinducer

Related Posts