Share this post on:

Name:
UltraNuclease Protein

Synonyms:
SMNE,Nuclease, UltraNuclease, Benzonase

Species Name:
Serratia marcescens

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
P13717

Gene Id:
Asp22-Asn266DTLESIDNCAVGCPTGGSSNVSIVRHAYTLNNNSTTKFANWVAYHITKDTPASGKTRNWKTDPALNPADTLAPADYTGANAALKVDRGHQAPLASLAGVSDWESLNYLSNITPQKSDLNQGAWARLEDQERKLIDRADISSVYTVTGPLYERDMGKLPGTQKAHTIPSAYWKVIFINNSPAVNHYAAFLFDQNTPKGADFCQFRVTVDEIEKRTGLIIWAGLPDDVQASLKSKPGVLPELMGCKN

Molecular Weight:
27.7kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Liquid

Endotoxin Name:
null

Reconstitution:

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
10mM Tris (pH7.4), 500mM NaCl, 2mM MgCl2, 50% glycerol

Quality Statement:
Multi Nuclease all-around nuclease, also called broad-spectrum nucleic acid enzyme, is a kind of comes from Serratia Marcescens restriction endonuclease. It is capable of degradation of all forms of DNA and RNA (double-stranded, single-stranded, linear, circular or superhelical forms) under a very wide range of conditions (6Murea, 0.1M GuanidineHCl, 0.4%TritonX100, 0.1%SDS, 1mM EDTA, 1mM PMSF). The formation of 3-5 oligonucleotide residues containing 5 ‘-phosphate terminus is widely used to remove nucleic acids from biological products. The expression and purification of this product in Escherichia coli(E.coli) through genetic engineering can not only reduce the viscosity of cell supernatant and cell lysate in scientific research, but also improve the efficiency of protein purification and functional research. It can also be used in virus purification, vaccine production, protein and polysaccharide pharmaceutical industry as a host residual nucleic acid removal reagent, reducing the host residual nucleic acid to the peak (pg) level to improve the efficacy and safety of biological products. And can effectively prevent human peripheral blood monocyte (PBMC) clumping in cell therapy and vaccine research.

Reference:
1.Nestle M, Roberts W K. An Extracellular Nuclease from Serratia marcescens I. PURIFICATION AND SOME PROPERTIES OF THE ENZYME[J]. Journal of Biological Chemistry, 1969, 244.2.Kim W Y, Lee H S, Suh S J, et al. Purification and Cellular Localization of Extracellular Nuclease of Serratia marcescens Expressed in Escherichia coli[J]. Korean Journal of Microbiology, 1994, 32(2):147-154.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-2 Protein
Nectin-2/CD112 Protein
Popular categories:
ADAMTS14
Caspase-3

Share this post on:

Author: Adenosylmethionine- apoptosisinducer