Share this post on:

Name:
TROP2 Protein

Synonyms:
TACSTD2, GA733-1, M1S1, TROP2

Species Name:
Mouse

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
Q8BGV3

Gene Id:
Gln25-Gly270, with C-terminal 8*His QSNCTCPTNKMTVCDTNGPGGVCQCRAMGSQVLVDCSTLTSKCLLLKARMSARKSGRSLVMPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVRRTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFQERYKLHPSFLSAVHYEEPTIQIELRQNASQKGLRDVDIADAAYYFERDIKGESLFMGRRGLDVQVRGEPLHVERTLIYYLDEKPPQFSMKRLTAGGGGSHHHHHHHH

Molecular Weight:
40-50kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Trophoblast cell-surface antigen 2 (TROP2), also known as tumor-associated calcium signal transducer 2 (TACSTD2), is a transmembrane glycoprotein with high homology to the epithelial cell. TROP2 was discovered first in trophoblast cells as a surface marker. Gene TACSTD2 located on chromosome 1p32 encodes TROP2. TROP2 consists of extracellular and transmembrane domains and a cytoplasmic tail. TROP2 undergoes intramembrane proteolysis and is cleaved into a large extracellular fragment and a short intracellular fragment. TROP2 increases intracellular calcium concentration, decreases fibronectin binding and cell adhesion, and increases cell motility. TROP2 is overexpressed in several carcinomas, such as colorectal, pancreatic, gastric, oral squamous cell carcinoma, ovarian, and breast cancers, compared with the corresponding normal tissue. Because TROP2 overexpression is associated with poor survival in patients with solid tumors, TROP2 has been considered a potential target for anticancer therapy. In studies of breast and lung cancers, TROP2 inhibition exerted anticancer effects.

Reference:
1、Ripani E. et al. (1998) Human Trop-2 is a tumor-associated calcium signal transducer. Int J Cancer. 76(5): 671-676.2、Wang J. et al. (2008) Identification of Trop-2 as an oncogene and an attractive therapeutic target in colon cancers. Mol Cancer Ther. 7(2): 280-285.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
LOX Protein
RecO Protein
Popular categories:
IFN-alpha 2b
CXC Chemokines

Share this post on:

Author: Adenosylmethionine- apoptosisinducer