Share this post on:

Name:
FGF-21 Protein

Synonyms:
FGF-21;Fibroblast Growth Factor 21, FGF-21, FGF21

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
Q9NSA1-1

Gene Id:
HHHHHHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Molecular Weight:
25-28 KDa(Reducing)

Purity:
>95%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.2, 5% trehalose

Quality Statement:
Fibroblast growth factor 21 (FGF-21) is a member of the FGF gene family. According to its structure, it is further classified as a member of the FGF19 subfamily. The subfamily includes FGF-19,-21 and-23. FGF-21 is an effective adipocyte glucose uptake activator that protects animals from diet-induced obesity when overexpressed in transgenic mice and reduces blood glucose and triglyceride levels during treatment in diabetic rodents. Some studies have shown that FGF-21 is a biomarker for the diagnosis of mitochondrial diseases. FGF-21 can cross the blood-brain barrier and regulate the phosphorylation cascade and gene expression in the whole hypothalamus. Intracerebroventricular injection of FGF21 can increase metabolic rate and insulin sensitivity in rats, but the site of action is not clear.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Capsid protein
Serpin A1a Protein
Popular categories:
TWEAK R
Estrogen Related Receptor-beta (ERRβ)

Share this post on:

Author: Adenosylmethionine- apoptosisinducer