Post Categories Uncategorized Post dateMarch 23, 2025Post last updated dateUpdated March 23, 2025 EGFR Protein Post author Adenosylmethionine- apoptosisinducerPost read time10 sec read Name: EGFR ProteinSynonyms: ERBB,ERRP,HER1,mENA,ERBB1Species Name: Rhesus macaqueLabel Name: Human Fc TagMarker Name: UnconjugatedAccession: P55245Gene...
Post Categories Uncategorized Post dateMarch 23, 2025Post last updated dateUpdated March 23, 2025 EphA1 Protein Post author Adenosylmethionine- apoptosisinducerPost read time9 sec read Name: EphA1 ProteinSynonyms: EPH Protein, EPHA9 Protein, EPHT Protein, EPHT1 ProteinSpecies Name: HumanLabel Name:...
Post Categories Uncategorized Post dateMarch 23, 2025Post last updated dateUpdated March 23, 2025 Tolfenpyrad Post author Adenosylmethionine- apoptosisinducerPost read time1 min read Product Name : TolfenpyradDescription:Tolfenpyrad is a chemical compound from the group of pyrazole-5-carboxamides and...
Post Categories Uncategorized Post dateMarch 22, 2025Post last updated dateUpdated March 22, 2025 DPP4/CD26 Protein Post author Adenosylmethionine- apoptosisinducerPost read time9 sec read Name: DPP4/CD26 ProteinSynonyms: CD26,ADABP,ADCP2,DPPIVSpecies Name: HumanLabel Name: His TagMarker Name: UnconjugatedAccession: Gene Id: Asn29-Pro766,...
Post Categories Uncategorized Post dateMarch 22, 2025Post last updated dateUpdated March 22, 2025 Procalcitonin Protein Post author Adenosylmethionine- apoptosisinducerPost read time6 sec read Name: ProCalcitonin ProteinSynonyms: ProCalcitonin,PCTSpecies Name: HumanLabel Name: His TagMarker Name: UnconjugatedAccession: P01258Gene Id: MHHHHHHDDDDKAPFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANMolecular...
Post Categories Uncategorized Post dateMarch 22, 2025Post last updated dateUpdated March 22, 2025 Her2 Protein Post author Adenosylmethionine- apoptosisinducerPost read time10 sec read Name: Her2 ProteinSynonyms: CD340,ERBB2,NEU,NGL,MLN19,TKR1Species Name: HumanLabel Name: His TagMarker Name: UnconjugatedAccession: P04626-1Gene Id: Thr23-Thr652,...
Post Categories Uncategorized Post dateMarch 22, 2025Post last updated dateUpdated March 22, 2025 Piracetam Post author Adenosylmethionine- apoptosisinducerPost read time1 min read Product Name : PiracetamDescription:Piracetam is a compound suggested to be both a nootropic and...
Post Categories Uncategorized Post dateMarch 21, 2025Post last updated dateUpdated March 21, 2025 FGF-10 Protein Post author Adenosylmethionine- apoptosisinducerPost read time7 sec read Name: FGF-10 ProteinSynonyms: Species Name: HumanLabel Name: No TagMarker Name: UnconjugatedAccession: O15520Gene Id: Leu40-Ser208LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHSMolecular...
Post Categories Uncategorized Post dateMarch 21, 2025Post last updated dateUpdated March 21, 2025 TGF-α Protein Post author Adenosylmethionine- apoptosisinducerPost read time7 sec read Name: TGF-α ProteinSynonyms: Species Name: HumanLabel Name: No TagMarker Name: UnconjugatedAccession: P01135Gene Id: Val40-Ala89VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAMolecular...
Post Categories Uncategorized Post dateMarch 21, 2025Post last updated dateUpdated March 21, 2025 MSLN/Mesothelin Protein Post author Adenosylmethionine- apoptosisinducerPost read time9 sec read Name: MSLN/Mesothelin ProteinSynonyms: Species Name: HumanLabel Name: His TagMarker Name: UnconjugatedAccession: Q13421-1Gene Id: Leu37-Arg286,...