Share this post on:

Name:
KGF/FGF-7 Protein

Synonyms:
FGF-7, Fibroblast growth factor 7, HBGF-7, Keratinocyte growth factor, KGF

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P21781

Gene Id:
Cys32-Thr194CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Molecular Weight:
17kDa (Reducing)

Purity:
>95% by SDS-PAGE & RP-HPLC

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution.1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 500mM NaCl, pH8.0

Quality Statement:
Fibroblast growth factor (FGF-7), a member of FGF family, is initially found to be secreted from mesenchymal cells to repair epithelial tissues. As a well-characterized paracrine growth factor for tissue growth and regeneration, fibroblast growth factor 7 (FGF-7) is involved in a number of physiological and pathological processes, including lung disease and cancer. The stromal-derived FGFs, such as FGF-7 and FGF-10, control epithelial cell resident FGFR2IIIb activities, promote net tissue homeostasis, and restraint tumor cells from progression to malignancy.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
LGALSL ProteinSpecies
CEACAM5 Proteinsupplier
Popular categories:
ALK-3
CPVL

Share this post on:

Author: Adenosylmethionine- apoptosisinducer