Share this post on:

Name:
TGF-α Protein

Synonyms:

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P01135

Gene Id:
Val40-Ala89VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

Molecular Weight:
30-33kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution.1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 150mM NaCl, pH8.0

Quality Statement:
Transforming growth factor alpha (TGF-α), a polypeptide of 5.5kDa that is partially homologous to epidermal growth factor (EGF), is important in the control of glial and Schwann cell proliferation and survival of differentiated neurons. TGF-α is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF-β to promote anchorage-independent cell proliferation in soft agar. Although TGF-α commonly acts via autocrine or paracrine signaling in solid tissues, it can also mediate paracrine signaling by activated macrophages, monocytes, neutrophils, and eosinophils.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Janus kinase 2/JAK2 proteinSource
IFN-omega Proteincustom synthesis
Popular categories:
Testicular Receptor 4
Influenza Virus Neuraminidase

Share this post on:

Author: Adenosylmethionine- apoptosisinducer