Share this post on:

Name:
HRSVL Glycoprotein G Protein

Synonyms:
HRSV Glycoprotein G, Glycoprotein GP55, Envelope glycoprotein B

Species Name:
HRSV

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
P20895

Gene Id:
His67-Gln298, with C-terminal 8*His HKVTLTTAIIQDATSQIKNTTPTYLTQDPQLGISFSNLSEITSQTTTILASTTPGVKSNLQPTTVKTKNTTTTQTQPSKPTTKQRQNKPPNKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTFKTTKKDHKPQTTKPKEVPTTKPTEEPTINTTKTNIITTLLTNNTTGNPKLTSQMETFHSTSSEGNLSPSQVSTTSEHPSQPSSPPNTTRQGGGSHHHHHHHH

Molecular Weight:
55-95kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Human respiratory syncytial virus (HRSV) is a major cause of lower respiratory tract disease in babies and vulnerable adults. The viral genome, a negative-sense single-stranded RNA molecule, encodes at least 11 distinct proteins, two of which (G and F) are the major surface glycoproteins anchored in the viral membrane. The G glycoprotein is the attachment protein that mediates virus binding to cells. The F glycoprotein mediates fusion of the viral and cell membranes for virus entry into the cell and fusion of the infected cell membrane with that of adjacent cells to pro mote syncytia formatio A characteristic feature of HRSV is that moderate levels of antibody do not provide lasting protection, although prior infection can modulate the severity of the disease. HSRV is classified in the genus Pneumovirus, subfamily Pneumovirinae, family Paramyxoviridae. Other members of this genus include RSV of cattle, goats and sheep, and pneumonia virus of mice (PVM).

Reference:
1、Melero J A. et al. (1997) Antigenic structure, evolution and immunobiology of human respiratory syncytial virus attachment (G) protein. J Gen Virol. 78 (10): 2411-2418.2、Trento A. (2006) Natural history of human respiratory syncytial virus inferred from phylogenetic analysis of the attachment (G) glycoprotein with a 60-nucleotide duplication. J Virol. 80(2): 975-984.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
FtsZ ProteinMedChemExpress
GM-CSF Proteincustom synthesis
Popular categories:
Protein Tyrosine Kinase 7
Frizzled-5

Share this post on:

Author: Adenosylmethionine- apoptosisinducer