Name:
IL-3β Protein
Synonyms:
Hematopoietic Growth Factor; MCGF; Multipotential Colony-stimulating Factor; P-cell-stimulating Factor
Species Name:
Rat
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P97688
Gene Id:
Met26-Cys169MISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC
Molecular Weight:
16kDa (Reducing)
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4.
Quality Statement:
Interleukin-3 (IL-3) is a type of biological signal (cytokine) which is encoded by the IL-3 gene located on chromosome 5 and produced primarily by activated T cells beside human thymic epithelial cells, activated murine mast cells, murine keratinocytes and neurons/astrocytes. It exerts its biological activities through binding to Interleukin-3 receptors included α and β subunits, but sequence analysis revealed a number of features indicative of the presence of only one β-subunit in the rat. Interleukin-3 acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. Furthermore, rat and human IL-3 share low homology and have not cross species activity.
Reference:
Martinez-Moczygemba, M. and D.P. Huston (2003) J. Allergy Clin. Immunol. 112:653.Mangi, M.H. and A.C. Newland (1999) Cytokines Cell. Mol. Ther. 5:87.Esandi, M. del C. et al. (1998) Gene 211:151.Cohen, D.R. et al. (1986) Nucleic Acids Res. 14:3641.Gebicke-Haerter, P.J. et al. (1994) J. Neuroimmunol. 50:203.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GMP IL-21 Proteinmanufacturer
MME ProteinBiological Activity
Popular categories:
IL-10 Receptor
CD284/TLR4
