FGF-19 Protein | Adenosylmethionine

Name:
FGF-19 Protein

Synonyms:
FGF-19

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
O95750

Gene Id:
Leu25-Lys216LAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEKKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQ ERLRRKE

Molecular Weight:
24kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 200mM NaCl, pH8.0

Quality Statement:
Fibroblast Growth Factors (FGFs) are polypeptides with diverse activities in development and physiology. The mammalian Fgf family can be divided into the intracellular Fgf11/12/13/14 subfamily (iFGFs), the hormone-like Fgf15/21/23 subfamily (hFGFs), and the canonical Fgf subfamilies, including Fgf1/2/5, Fgf3/4/6, Fgf7/10/22, Fgf8/17/18, and Fgf9/16/20. FGF-19 is secreted from ileal enterocytes similar to a hormone. Endocrine derived hormone FGF-19 has recently emerged as a potential target for the treatment of metabolic diseases. In recognition of the skeletal muscle as an important metabolic organ, it is considered that FGF-19 may also have a role in muscle metabolism and may be a new factor with promising value in the treatment of sarcopenia.

Reference:
1.\tRabia Bag Soytas, Veysel Suzan, Pinar Arman. Association of FGF-19 and FGF-21 levels with primary sarcopenia. Geriatr Gerontol Int. 2021 Oct;21(10):959-962. doi: 10.1111/ggi.14263. Epub 2021 Aug 17. 2.\tNobuyuki Itoh 1, David M Ornitz. Functional evolutionary history of the mouse Fgf gene family. Dev Dyn. 2008 Jan;237(1):18-27. doi: 10.1002/dvdy.21388.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
HADHB ProteinStorage & Stability
BMP-4 Proteinsite
Popular categories:
ADAMTS19
Nectin-2/CD112

Author: Adenosylmethionine- apoptosisinducer

Related Posts