Name:
Biotinylated OX40/TNFRSF4/CD134 Protein
Synonyms:
Txgp1; OX40L receptor; ACT35
Species Name:
Mouse
Label Name:
Avi Tag, His Tag
Marker Name:
Biotin
Accession:
P47741
Gene Id:
Val20-Pro211VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGPGGGSHHHHHHHHGLNDIFEAQKIEWHE
Molecular Weight:
43-55kDa (Reducing)
Purity:
＞95% by SDS-PAGE & >95% by SEC-HPLC
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, PH7.4, 5% trehalose
Quality Statement:
OX40 belongs to the tumor necrosis factor receptor superfamily, and its expression is restricted to activated T-cells. Ligation of OX40 during T-cell-dendritic cell interaction is crucial for clonal expansion of antigen-specific T-cells and generation of T-cell memory. Recent studies with animal models have indicated the critical involvement of OX40 in the pathogenesis of a variety of immunologic abnormalities of inflammatory, autoimmune, infectious, allergic, and allotransplantation-related diseases. Blockade of OX40–OX40L（The ligand of OX40） interaction has been shown to prevent, cure, or ameliorate these diseases. In contrast, activation of OX40 is known to break an existing state of tolerance in malignancies, leading to a reactivation of antitumor immunity. These findings clearly suggest that the OX40/OX40L system is one of the most promising targets of immune intervention for treatment of these diseases.
Reference:
1. Cancer Res. Roles of OX40 in the pathogenesis and the control of diseases.Int J Hematol . 2006 Jan;83(1):17-22. doi: 10.1532/IJH97.05151.2009 Oct 1,69(19):7747-55. Toshiyuki Hori.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
AARS1 Proteincustom synthesis
EphA3 Proteincustom synthesis
Popular categories:
HIV-1 gp120
PAR-1
