Name:
IL-7 Protein
Synonyms:
IL-7, Interleukin-7
Species Name:
Human
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P13232
Gene Id:
Asp26-His177 MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Molecular Weight:
18kDa (Reducing)
Purity:
>95% by SDS-PAGE&RP-HPLC
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4
Quality Statement:
IL7, also known as interleukin 7, is a hematopoietic growth factor that belongs to the IL-7/IL-9 family. It is secreted by stromal cells in the bone marrow and thymus. It is also produced by keratinocytes, dendritic cells, hepatocytes, neurons, and epithelial cells, but is not produced by lymphocytes. Human IL‑7 cDNA encodes 177 amino acids (aa) that include a 25 aa signal peptide. Human IL-7 shares approximately 60-63% aa sequence identity with mouse, rat, canine and feline IL-7, and 72-76% with equine, bovine, ovine, and porcine IL-7. IL7 stimulates the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. Like other common gamma-chain cytokines like IL-2 and IL-15, IL-7 and its receptor, IL-7R, have been used in a variety of immunotherapy applications, often in fluid tumors and in some instances of solid tumor models.
Reference:
1.Tan J, Wang C, Jin Y, Xia Y, Gong B, Zhao Q. Optimal combination of MYCN differential gene and cellular senescence gene predicts adverse outcomes in patients with neuroblastoma. Front Immunol. 2023 Nov 16; 14:1309138. 2.Padovano C, Bianco SD, Sansico F, De Santis E, Tamiro F, Colucci M, Totti B, Di Iasio S, Bruno G, Panelli P, Miscio G, Mazza T, Giambra V. The Notch1 signaling pathway directly modulates the human RANKL-induced osteoclastogenesis. Sci Rep. 2023 Dec 1;13(1):21199.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cathepsin B Proteinsupplier
IL-1R2 Proteincustom synthesis
Popular categories:
CD121b/IL-1 Receptor 2
CD301/CLEC10A