Share this post on:

Name:
IL-7 Protein

Synonyms:
IL-7, Interleukin-7

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P13232

Gene Id:
Asp26-His177 MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Molecular Weight:
18kDa (Reducing)

Purity:
>95% by SDS-PAGE&RP-HPLC

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
IL7, also known as interleukin 7, is a hematopoietic growth factor that belongs to the IL-7/IL-9 family. It is secreted by stromal cells in the bone marrow and thymus. It is also produced by keratinocytes, dendritic cells, hepatocytes, neurons, and epithelial cells, but is not produced by lymphocytes. Human IL‑7 cDNA encodes 177 amino acids (aa) that include a 25 aa signal peptide. Human IL-7 shares approximately 60-63% aa sequence identity with mouse, rat, canine and feline IL-7, and 72-76% with equine, bovine, ovine, and porcine IL-7. IL7 stimulates the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. Like other common gamma-chain cytokines like IL-2 and IL-15, IL-7 and its receptor, IL-7R, have been used in a variety of immunotherapy applications, often in fluid tumors and in some instances of solid tumor models.

Reference:
1.Tan J, Wang C, Jin Y, Xia Y, Gong B, Zhao Q. Optimal combination of MYCN differential gene and cellular senescence gene predicts adverse outcomes in patients with neuroblastoma. Front Immunol. 2023 Nov 16; 14:1309138. 2.Padovano C, Bianco SD, Sansico F, De Santis E, Tamiro F, Colucci M, Totti B, Di Iasio S, Bruno G, Panelli P, Miscio G, Mazza T, Giambra V. The Notch1 signaling pathway directly modulates the human RANKL-induced osteoclastogenesis. Sci Rep. 2023 Dec 1;13(1):21199.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Cathepsin B Proteinsupplier
IL-1R2 Proteincustom synthesis
Popular categories:
CD121b/IL-1 Receptor 2
CD301/CLEC10A

Share this post on:

Author: Adenosylmethionine- apoptosisinducer